DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hspb1

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001072817.1 Gene:hspb1 / 780278 XenbaseID:XB-GENE-480320 Length:211 Species:Xenopus tropicalis


Alignment Length:132 Identity:44/132 - (33%)
Similarity:70/132 - (53%) Gaps:13/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LSRGGASNKQ--GNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLP 131
            ||.|.:..:|  ..:::.|||..|.|.||.:|..:..:.:.|||||::|:||.:||.|.|:|.||
 Frog    87 LSSGISEIRQTSDQWKISLDVNHFAPEELVIKTKDGIVEITGKHEEKQDEHGFISRCFTRKYTLP 151

  Fly   132 KEFDSDAIVSTLSEDGVLNITVP---PLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPAASA 193
            ...|.:.:.|:||.||:|.:..|   |.:...|:   .|||.....:::     |..||.....|
 Frog   152 PGVDINKVASSLSPDGILTVEAPLPKPAIQSAEI---AIPITFQSRAEI-----GTTEAKKGEEA 208

  Fly   194 SE 195
            ::
 Frog   209 TK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 31/80 (39%)
IbpA <79..170 CDD:223149 35/93 (38%)
hspb1NP_001072817.1 ACD_HspB1_like 90..175 CDD:107230 32/84 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.