DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Hspb2

DIOPT Version :10

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_077761.3 Gene:Hspb2 / 69253 MGIID:1916503 Length:182 Species:Mus musculus


Alignment Length:96 Identity:41/96 - (42%)
Similarity:54/96 - (56%) Gaps:6/96 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RNGELAALSRGGASN---KQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRH 123
            |.||.|   |.|||.   .:|.|:..|||..|.|.|:||:.|:..:.|..:|.:|.|.||.|||.
Mouse    55 RAGEGA---RAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSRE 116

  Fly   124 FVRRYPLPKEFDSDAIVSTLSEDGVLNITVP 154
            |.|.|.||.:.|...:.:.||.||:||:..|
Mouse   117 FCRTYVLPADVDPWRVRAALSHDGILNLEAP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 33/81 (41%)
Hspb2NP_077761.3 Crystallin <21..51 CDD:425732
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 67..148 CDD:469641 33/81 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.