DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Hspb3

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_064344.1 Gene:Hspb3 / 56534 MGIID:1928479 Length:154 Species:Mus musculus


Alignment Length:137 Identity:39/137 - (28%)
Similarity:64/137 - (46%) Gaps:9/137 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PNRMYRRLHSRQHHDLDL-HTLGLIARMGAHAHHLVANKRNGELAALSRGGASNK------QGNF 81
            |.|......:|...|..| ||  |.|..|.....|...:..|...||:...||.:      :..|
Mouse    13 PVRYQEEFEARGLEDCRLDHT--LYALPGPTIEDLSKARGAGTPQALAEDSASTEKPPGEGKSRF 75

  Fly    82 EVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSED 146
            ::.|||..|.|.::.::.....::::.:|..|.|:||.:||.|.|:|.||...::..:.:.|..|
Mouse    76 QILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVETKDLSAILCHD 140

  Fly   147 GVLNITV 153
            |:|.:.|
Mouse   141 GILVVEV 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 24/85 (28%)
IbpA <79..170 CDD:223149 23/75 (31%)
Hspb3NP_064344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..71 5/22 (23%)
ACD_HspB3_Like 67..149 CDD:107232 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.