DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hspb15

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001092202.1 Gene:hspb15 / 555589 ZFINID:ZDB-GENE-080214-5 Length:154 Species:Danio rerio


Alignment Length:91 Identity:38/91 - (41%)
Similarity:55/91 - (60%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 NFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLS 144
            :::|.||||.|.|.|::||..:..:.:.|.||||:::|..:||.|.|:|.||.:.|...|.|.||
Zfish    38 DWKVCLDVGPFSPEEISVKTRDGYLEITGNHEERQENHRLISRSFARKYKLPADLDLKQISSMLS 102

  Fly   145 EDGVLNITVPPLVSKEELK-ERIIPI 169
            .||||::..|...|..... |.:|||
Zfish   103 PDGVLSVEAPLTGSNISFPGEIVIPI 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 32/73 (44%)
IbpA <79..170 CDD:223149 38/91 (42%)
hspb15NP_001092202.1 metazoan_ACD 35..113 CDD:107247 32/74 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.