DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hspb7

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001006040.1 Gene:hspb7 / 450019 ZFINID:ZDB-GENE-041010-136 Length:161 Species:Danio rerio


Alignment Length:99 Identity:27/99 - (27%)
Similarity:41/99 - (41%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GASNKQG----------NFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRR 127
            |..|:.|          .::..:||..|.|.::.|...|..|.|   |.|:....|.|...|..:
Zfish    55 GFPNRTGTVGNIKTLGDTYQFTVDVQDFSPEDVIVTTSNNQIEV---HAEKLASDGTVMNTFTHK 116

  Fly   128 YPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEE 161
            ..||::.|..::.|:|..||.|.|......:|.|
Zfish   117 CRLPEDVDPTSVKSSLGADGTLTIKAQRNTAKLE 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 24/88 (27%)
IbpA <79..170 CDD:223149 25/93 (27%)
hspb7NP_001006040.1 ACD_HspB7_like 64..144 CDD:107234 22/82 (27%)
IbpA <65..158 CDD:223149 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582893
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.