DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Hsp27

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster


Alignment Length:193 Identity:80/193 - (41%)
Similarity:107/193 - (55%) Gaps:43/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YGHDMF-PNRMYRRLHSRQHHDLDLHTLGLIARM-----GAHAHHLVANKR-----NGELAALSR 71
            :.||:| |.|:           |..:||||..|.     .:|.||...::|     |..|.|:.:
  Fly    34 HAHDLFHPRRL-----------LLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGPNALLPAVGK 87

  Fly    72 GGASNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDS 136
            .|       |:|.:||..|:|.|||||:|:..:|||||||||||.||.:.|||||:|.|||.||.
  Fly    88 DG-------FQVCMDVSQFKPNELTVKVVDNTVVVEGKHEEREDGHGMIQRHFVRKYTLPKGFDP 145

  Fly   137 DAIVSTLSEDGVLNITVPPLVSKEELK-ERIIPIKHVGPSDL-------------FQNGNGHK 185
            :.:|||:|.||||.:..||..|||:.| |||:.|:..||:.|             .:||:|.|
  Fly   146 NEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVKAPAPEAGDGKAENGSGEK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 44/78 (56%)
IbpA <79..170 CDD:223149 53/91 (58%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 45/83 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452097
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
109.900

Return to query results.
Submit another query.