DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Hsp23

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001246694.1 Gene:Hsp23 / 39077 FlyBaseID:FBgn0001224 Length:186 Species:Drosophila melanogaster


Alignment Length:192 Identity:79/192 - (41%)
Similarity:107/192 - (55%) Gaps:20/192 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPDIPFVLNL-DSPDSMYYGHDMFPNRMYRRLH-SRQHHDLDLHTLGLIARMGAHAHHLVANKRN 63
            |.:||.:|:| |....|    .|.|  .|...: .||.:..    |.|:..|......|  .|:.
  Fly     1 MANIPLLLSLADDLGRM----SMVP--FYEPYYCQRQRNPY----LALVGPMEQQLRQL--EKQV 53

  Fly    64 GELAALSRGGASNKQG--NFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVR 126
            |  |:....||.:|.|  .|:|.:||..|:|.||.||:.:..::|||.|||||||||.::|||||
  Fly    54 G--ASSGSSGAVSKIGKDGFQVCMDVSHFKPSELVVKVQDNSVLVEGNHEEREDDHGFITRHFVR 116

  Fly   127 RYPLPKEFDSDAIVSTLSEDGVLNITVP-PLVSKEELKERIIPIKHVGPSDLFQNGNGHKEA 187
            ||.||..:::|.:.||||.||||.|.|| |...:::..|||:.|:.|||:.|....| .|||
  Fly   117 RYALPPGYEADKVASTLSSDGVLTIKVPKPPAIEDKGNERIVQIQQVGPAHLNVKEN-PKEA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 43/80 (54%)
IbpA <79..170 CDD:223149 48/93 (52%)
Hsp23NP_001246694.1 metazoan_ACD 67..145 CDD:107247 43/77 (56%)
IbpA <69..161 CDD:223149 47/91 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469601
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.