Sequence 1: | NP_523994.1 | Gene: | Hsp67Bc / 39071 | FlyBaseID: | FBgn0001229 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523998.1 | Gene: | Hsp67Ba / 39076 | FlyBaseID: | FBgn0001227 | Length: | 445 | Species: | Drosophila melanogaster |
Alignment Length: | 324 | Identity: | 86/324 - (26%) |
---|---|---|---|
Similarity: | 125/324 - (38%) | Gaps: | 132/324 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 IPFVLNL-------------DSPDSMYYGHDMFPNRMYRRLH------SRQHHDLDLHTLGLIAR 49
Fly 50 MGAHAHH---LVANKRNG-----------ELAALSRGGAS-----------------NKQGNFEV 83
Fly 84 HLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGV 148
Fly 149 LNITVPP----LVSKEELKERIIPIKHVG------------PSDLFQ------------------ 179
Fly 180 -----------NGNGHKE-----------------------------AGPAASA----SEPEAK 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hsp67Bc | NP_523994.1 | metazoan_ACD | 75..154 | CDD:107247 | 41/95 (43%) |
IbpA | <79..170 | CDD:223149 | 45/94 (48%) | ||
Hsp67Ba | NP_523998.1 | metazoan_ACD | 124..200 | CDD:107247 | 39/76 (51%) |
DNA_pol3_delta2 | <218..>381 | CDD:331068 | 16/106 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45469595 | |
Domainoid | 1 | 1.000 | 51 | 1.000 | Domainoid score | I4315 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 67 | 1.000 | Inparanoid score | I3937 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1187096at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000383 | |
OrthoInspector | 1 | 1.000 | - | - | otm14686 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR45640 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.900 |