DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and CG7409

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster


Alignment Length:118 Identity:46/118 - (38%)
Similarity:70/118 - (59%) Gaps:13/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ALSRGGAS--------NKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHF 124
            :|||.|::        .|.| ||.::||.||:|.|::||...:.:|||.|||:|.|....|.||.
  Fly    38 SLSRVGSAPDLSRVIVGKDG-FEANVDVHLFKPYEISVKTSGDTVVVEAKHEKRRDGDTFVGRHI 101

  Fly   125 VRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPIKHVGPSDL 177
            |:|:.||:.:..:.:.|.||.||:|.:..||.::    .||.:.::.||||.|
  Fly   102 VKRFVLPRGYYPNDVRSELSSDGILTVKCPPYLT----NERSVYVRQVGPSYL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 33/86 (38%)
IbpA <79..170 CDD:223149 36/90 (40%)
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 33/77 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.