DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and l(2)efl

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001261156.1 Gene:l(2)efl / 37744 FlyBaseID:FBgn0011296 Length:187 Species:Drosophila melanogaster


Alignment Length:100 Identity:47/100 - (47%)
Similarity:64/100 - (64%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 FEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSE 145
            |||.|||..|.|.|:|||:.::.::|||||||::|:||:|||.|.|||.||.:.:.|.:.|:||.
  Fly    79 FEVILDVQQFSPSEITVKVADKFVIVEGKHEEKQDEHGYVSRQFSRRYQLPSDVNPDTVTSSLSS 143

  Fly   146 DGVLNITVPPLVSKEELKERIIPIKHVGPSDLFQN 180
            ||:|.|..|.........||::.|...|||....|
  Fly   144 DGLLTIKAPMKALPPPQTERLVQITQTGPSSKEDN 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 39/72 (54%)
IbpA <79..170 CDD:223149 42/88 (48%)
l(2)eflNP_001261156.1 metazoan_ACD 71..153 CDD:107247 39/73 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469596
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
109.900

Return to query results.
Submit another query.