DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Hsp22

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001027114.1 Gene:Hsp22 / 3772576 FlyBaseID:FBgn0001223 Length:174 Species:Drosophila melanogaster


Alignment Length:128 Identity:54/128 - (42%)
Similarity:77/128 - (60%) Gaps:21/128 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NKQGNFEVHLDVGLFQPGELTVKLVNECIV-VEGKHEERE-DDHGHVSRHFVRRYPLPKEFDSDA 138
            ||.| :::.|||..:  .||.||:::|.:| ||||.|::| :..|:.||||:||:.||:.:::|.
  Fly    60 NKDG-YKLTLDVKDY--SELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADK 121

  Fly   139 IVSTLSEDGVLNITVP-PLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPA-ASASEPEAK 199
            :.||||.||||.|:|| |...:|.||||.:.|:..|.              || .||.||..|
  Fly   122 VTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGE--------------PAKKSAEEPNDK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 37/79 (47%)
IbpA <79..170 CDD:223149 43/93 (46%)
Hsp22NP_001027114.1 IbpA 17..154 CDD:223149 45/96 (47%)
metazoan_ACD 61..138 CDD:107247 37/79 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469607
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.