DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hspb1

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001008615.2 Gene:hspb1 / 368243 ZFINID:ZDB-GENE-030326-4 Length:199 Species:Danio rerio


Alignment Length:170 Identity:53/170 - (31%)
Similarity:73/170 - (42%) Gaps:54/170 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YGHDMFPNRM-------------YRRLHSRQHHDLDLHTLGLIARMGAHAHHLVANKRNGELAAL 69
            :||..|.:.|             |.|..|||                                 |
Zfish    57 FGHPEFASLMQGPPVMPPMMTPSYGRALSRQ---------------------------------L 88

  Fly    70 SRGGASNKQ--GNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPK 132
            |.|.:..||  .::::.|||..|.|.||.||..:..:.:.||||||:|:||.:||.|.|:|.||.
Zfish    89 SSGMSEVKQTGDSWKISLDVNHFSPEELNVKTKDGVLEITGKHEERKDEHGFISRCFTRKYTLPP 153

  Fly   133 EFDSDAIVSTLSEDGVLNITVP---PLVSKEELKERIIPI 169
            ..||:.|.|.||.:|||.:..|   |.:...|:.   ||:
Zfish   154 GVDSEKISSCLSPEGVLTVEAPLPKPAIQAPEVN---IPV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 36/80 (45%)
IbpA <79..170 CDD:223149 39/94 (41%)
hspb1NP_001008615.2 ACD_HspB1_like 91..176 CDD:107230 37/84 (44%)
IbpA <94..191 CDD:223149 41/100 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.