DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Hspb9

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001102305.1 Gene:Hspb9 / 363681 RGDID:1309122 Length:203 Species:Rattus norvegicus


Alignment Length:183 Identity:39/183 - (21%)
Similarity:72/183 - (39%) Gaps:38/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 MYYGHDMFPNRMYRRLHSRQHHDLDLHTLGLIA----RMGAHAHHLVANKRN-----------GE 65
            |:.|....|..:.::||||........:.|...    |:.:....:..::||           .:
  Rat    16 MWGGGGGSPRALRQQLHSRMQRVGSSFSTGQREPGENRVASRCPSVALSERNQAATLPVRLLKDD 80

  Fly    66 LAALSRGGASNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHG----HVSRHFVR 126
            |||....|.  ::.:|::.||...|.|.:|.|::..:.::|.||.::..:|..    .:.:...|
  Rat    81 LAAAHANGC--EEPSFQMKLDAHGFAPEDLVVRIDGQNLMVTGKRQQESNDPSRGRYRLEQSVHR 143

  Fly   127 RYPLPKEFDSDAIVSTLSEDGVL-----NITVPPLVSKEELKERIIPIKHVGP 174
            :..||...|..|:..:|:..|.|     |..:|            :|....||
  Rat   144 QMQLPMTLDPAAMTCSLTPSGHLWFKGQNKCLP------------LPEAQTGP 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 20/87 (23%)
IbpA <79..170 CDD:223149 22/99 (22%)
Hspb9NP_001102305.1 ACD_HspB9_like 87..172 CDD:107236 20/86 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342802
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.