DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and CG13133

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster


Alignment Length:211 Identity:67/211 - (31%)
Similarity:95/211 - (45%) Gaps:42/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YGHDMF--PNRMY-------RRLHSRQHHDLDLHTLGLIARMG----AHAHHLVAN---KRNGEL 66
            :||..:  |.|.:       |:.|....||||:.......||.    .|...||..   :...|.
  Fly    15 HGHHHWQPPRRHWSTGESKCRQRHYYLSHDLDVCARDFHLRMDDSAWCHGSCLVGRVVIETGTEP 79

  Fly    67 AALSRGGASNKQGNFEVHLDVGLFQPGELTVKLVN-ECIVVEGKHEEREDDHGH--VSRHFVRRY 128
            .:|.|       |.|:|.|||..||..|||||..| :.:.||||..:...:.|.  ::|.|.|.|
  Fly    80 DSLGR-------GTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSY 137

  Fly   129 PLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPIKHVG-----------PSDLFQ--- 179
            .||:.:|:....:|.|.||:|.||||.....::: ||.|.|:..|           |..:.|   
  Fly   138 KLPRHYDATQARATFSADGILMITVPAPPKLDDV-EREIEIEPTGNYFGSVSDPTAPKAIEQADV 201

  Fly   180 NGNGHKEAGPAASASE 195
            :|:| .||.||.:|.:
  Fly   202 DGDG-GEANPAGTAMD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 33/81 (41%)
IbpA <79..170 CDD:223149 38/93 (41%)
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 32/75 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.