DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and HSPB8

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_055180.1 Gene:HSPB8 / 26353 HGNCID:30171 Length:196 Species:Homo sapiens


Alignment Length:100 Identity:33/100 - (33%)
Similarity:54/100 - (54%) Gaps:11/100 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 FEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSE 145
            ::|.::|..|:|.||.||..:..:.|.|||||::.:.|.||::|.::..||.|.|...:.::||.
Human    96 WKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSP 160

  Fly   146 DGVLNITVPPLVSKEELKERIIPIKHVGPSDLFQN 180
            :|:|.|..|          ::.|....|.|. |.|
Human   161 EGLLIIEAP----------QVPPYSTFGESS-FNN 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 27/72 (38%)
IbpA <79..170 CDD:223149 29/88 (33%)
HSPB8NP_055180.1 ACD_HspB8_like 80..170 CDD:107235 28/83 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.