DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Cryaa

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001276666.1 Gene:Cryaa / 24273 RGDID:2413 Length:196 Species:Rattus norvegicus


Alignment Length:195 Identity:60/195 - (30%)
Similarity:91/195 - (46%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IPFVLNLDSPDSMYYGHDMFPNRMYRRLHSRQHHDLDLHTLGLIARMG--AHAHHLVANKRNGEL 66
            :||:.:..||   ||...:|     |.:       ||.....|:..|.  .|..| ..|.:|   
  Rat    37 LPFLSSTISP---YYRQSLF-----RTV-------LDSGISELMTHMWFVMHQPH-AGNPKN--- 82

  Fly    67 AALSRGGASNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLP 131
               :.|...:.:..|.:.|||..|.|.:||||::.:.:.:.|||.||:||||::||.|.|||.||
  Rat    83 ---NPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLP 144

  Fly   132 KEFDSDAIVSTLSEDGVLNITVPPLVSKEEL--KERIIPIKHVGPSDLFQNGNGHKEAGPAASAS 194
            ...|..|:..:||.||:|..:.|.:.|..:.  .||.||:.              :|..|:::.|
  Rat   145 SNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVS--------------REEKPSSAPS 195

  Fly   195  194
              Rat   196  195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 34/78 (44%)
IbpA <79..170 CDD:223149 40/92 (43%)
CryaaNP_001276666.1 Crystallin 1..51 CDD:395419 6/16 (38%)
alpha-crystallin-Hsps_p23-like 86..168 CDD:412199 34/81 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342790
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.