DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hsp-12.1

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001076614.1 Gene:hsp-12.1 / 188710 WormBaseID:WBGene00011906 Length:112 Species:Caenorhabditis elegans


Alignment Length:85 Identity:30/85 - (35%)
Similarity:45/85 - (52%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKH---EEREDDHGHVSRHFVRRYPLPKEFDS 136
            :|....|||.||.|.|.|.::.||:....|::..:|   :.|..::|.|:|...|.|.||::.|.
 Worm    28 TNTSEKFEVGLDAGFFGPNDIDVKVNGIEIIIHLRHDLLQNRPTEYGIVNREVHRTYKLPEDVDP 92

  Fly   137 DAIVSTLSEDGVLNITVPPL 156
            ..:.|.|:..|||.||...|
 Worm    93 STVRSHLNSSGVLTITANKL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 29/81 (36%)
IbpA <79..170 CDD:223149 29/81 (36%)
hsp-12.1NP_001076614.1 metazoan_ACD 26..111 CDD:107247 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.