Sequence 1: | NP_523994.1 | Gene: | Hsp67Bc / 39071 | FlyBaseID: | FBgn0001229 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343638.1 | Gene: | F58H7.1 / 186550 | WormBaseID: | WBGene00019067 | Length: | 692 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 43/201 - (21%) |
---|---|---|---|
Similarity: | 74/201 - (36%) | Gaps: | 57/201 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 PDIPFVLN-LDSPDSMYYGHDMFPNRMYRRLHS------RQHHDLDLHTL-GLIA---RMGAHA- 54
Fly 55 --HHLVANKRNG----------ELAALSRGGASNKQG--NFE-VHLDVG-----LFQPGELTVKL 99
Fly 100 VNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKE 164
Fly 165 RIIPIK 170 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hsp67Bc | NP_523994.1 | metazoan_ACD | 75..154 | CDD:107247 | 14/86 (16%) |
IbpA | <79..170 | CDD:223149 | 18/98 (18%) | ||
F58H7.1 | NP_001343638.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |