DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and F58H7.1

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001343638.1 Gene:F58H7.1 / 186550 WormBaseID:WBGene00019067 Length:692 Species:Caenorhabditis elegans


Alignment Length:201 Identity:43/201 - (21%)
Similarity:74/201 - (36%) Gaps:57/201 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PDIPFVLN-LDSPDSMYYGHDMFPNRMYRRLHS------RQHHDLDLHTL-GLIA---RMGAHA- 54
            |:.|..|| |:.|:.     ...|||......|      :.|.....|.| |.|:   :.|.|| 
 Worm   215 PNGPNGLNGLNDPNG-----SNSPNRQLPHEQSDANGQAQSHGPFGFHGLQGPISQNVQAGTHAS 274

  Fly    55 --HHLVANKRNG----------ELAALSRGGASNKQG--NFE-VHLDVG-----LFQPGELTVKL 99
              |.|  |..||          :..|:......:..|  ||| :::..|     :.:...||..:
 Worm   275 NEHGL--NSPNGPNNPNDHQAPDANAIDVKMHRSLDGVENFESIYITAGWKDTEMDRRSNLTTGV 337

  Fly   100 VNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKE 164
            |...::.:  |.|.:::             :..:.|.|::...::.|...:|..   :.|..:|.
 Worm   338 VKLRVICD--HSETKEE-------------IKLKGDEDSVTIEITMDQKYDIEE---MEKHHIKA 384

  Fly   165 RIIPIK 170
            .|.|:|
 Worm   385 HITPLK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 14/86 (16%)
IbpA <79..170 CDD:223149 18/98 (18%)
F58H7.1NP_001343638.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.