DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and F08H9.4

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_506586.1 Gene:F08H9.4 / 184215 WormBaseID:WBGene00008592 Length:147 Species:Caenorhabditis elegans


Alignment Length:132 Identity:39/132 - (29%)
Similarity:61/132 - (46%) Gaps:26/132 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KRNGELAALSR--GGAS--------------------NKQGNFEVHLDVGLFQPGELTVKLVNEC 103
            ||:.:|..:.|  ||..                    |....|.|:|:|..|:|.||.|.|....
 Worm    10 KRDSQLGEMMRDMGGMQRRLMPISGTFNPMTDDSEIMNSNDKFAVNLNVSNFKPEELKVNLEGRQ 74

  Fly   104 IVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIP 168
            :.::|:|:. |::||...:.|.|...||::.|..::.:.||.||.|.|..|.|   |.:..|.:|
 Worm    75 LSIQGEHDV-ENEHGASRKSFSRMILLPEDVDITSVATNLSNDGKLCIEAPKL---EGVCGRSVP 135

  Fly   169 IK 170
            :|
 Worm   136 VK 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 27/98 (28%)
IbpA <79..170 CDD:223149 31/90 (34%)
F08H9.4NP_506586.1 metazoan_ACD 47..125 CDD:107247 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.