DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hsp-43

DIOPT Version :10

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001123107.2 Gene:hsp-43 / 180895 WormBaseID:WBGene00002024 Length:393 Species:Caenorhabditis elegans


Alignment Length:116 Identity:37/116 - (31%)
Similarity:64/116 - (55%) Gaps:2/116 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIV 140
            |....|.|.:|...|:|.|:.||.:::.:::||:||:..|.......:|||:|.||::.|.::|.
 Worm   109 NDDRRFAVDMDCYQFRPEEIQVKTLDDTLMIEGRHEDIRDKDNFTKMYFVRKYQLPRDVDFNSIQ 173

  Fly   141 STLSEDGVLNITVPPLVSKE-ELKERIIPIKHVG-PSDLFQNGNGHKEAGP 189
            |::...|.|.:......:.. :.:||:|||:..| .|..|:||....:.||
 Worm   174 SSIDAKGRLQVEAGKFNNMALQGRERMIPIEGAGHHSPRFENGTLRSQRGP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 25/77 (32%)
hsp-43NP_001123107.2 metazoan_ACD 107..186 CDD:107247 25/76 (33%)

Return to query results.
Submit another query.