DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hsp-25

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 / 180872 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans


Alignment Length:141 Identity:38/141 - (26%)
Similarity:65/141 - (46%) Gaps:15/141 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PNRMYRRLHSRQHHDLDLHTLGLIARMGAHAHH----LVANKRNGE------LAALSRGGASNKQ 78
            |...|....|  ||:....|.|..:.:...:.|    |:|::...:      .:.|.:..:..| 
 Worm    76 PYNAYSNTSS--HHETSNRTGGFGSPLPPPSFHGPSDLMAHRPTYDPYLDNLKSPLIKDESDGK- 137

  Fly    79 GNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTL 143
             ...:..||..::|.|:|||.::..::|..||||:.... .|.|.:.:.:.||:..:.:.|.|||
 Worm   138 -TLRLRFDVANYKPEEVTVKTIDNRLLVHAKHEEKTPQR-TVFREYNQEFLLPRGTNPEQISSTL 200

  Fly   144 SEDGVLNITVP 154
            |.||||.:..|
 Worm   201 STDGVLTVEAP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 26/78 (33%)
IbpA <79..170 CDD:223149 26/76 (34%)
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 27/84 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.