DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hsp-16.2

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001379929.1 Gene:hsp-16.2 / 178659 WormBaseID:WBGene00002016 Length:145 Species:Caenorhabditis elegans


Alignment Length:95 Identity:34/95 - (35%)
Similarity:55/95 - (57%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIV 140
            |....|.::|:|..|:|.:|.:.|....:.::|: :|.:.|||:..:.|.|...||::.|..|:.
 Worm    45 NNDQKFAINLNVSQFKPEDLKINLDGRTLSIQGE-QELKTDHGYSKKSFSRVILLPEDVDVGAVA 108

  Fly   141 STLSEDGVLNITVPPLVSKEELKERIIPIK 170
            |.|||||.|:|..|   .||.::.|.|||:
 Worm   109 SNLSEDGKLSIEAP---KKEAVQGRSIPIQ 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 27/77 (35%)
IbpA <79..170 CDD:223149 32/90 (36%)
hsp-16.2NP_001379929.1 metazoan_ACD 42..123 CDD:107247 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160442
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.