DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hsp-12.3

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_501667.1 Gene:hsp-12.3 / 177777 WormBaseID:WBGene00002012 Length:109 Species:Caenorhabditis elegans


Alignment Length:86 Identity:29/86 - (33%)
Similarity:44/86 - (51%) Gaps:4/86 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 RGGASNKQGNFEVHLDVGL----FQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLP 131
            :|....|..::|.|.:|||    |.|.|:.||.:.|.:.:...|..::|..|.::|...|.|.||
 Worm    19 KGDGVVKVLDYEDHFEVGLEAHNFLPNEIDVKNIGEFLEIHMAHTTKDDKFGSITRSITRCYRLP 83

  Fly   132 KEFDSDAIVSTLSEDGVLNIT 152
            |..|...|.|.|...|:|:|:
 Worm    84 KGTDPATIKSKLDGSGILHIS 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 28/82 (34%)
IbpA <79..170 CDD:223149 27/78 (35%)
hsp-12.3NP_501667.1 metazoan_ACD 30..107 CDD:107247 27/75 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14686
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.