DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and sip-1

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_499316.1 Gene:sip-1 / 176471 WormBaseID:WBGene00004798 Length:159 Species:Caenorhabditis elegans


Alignment Length:141 Identity:41/141 - (29%)
Similarity:61/141 - (43%) Gaps:19/141 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AHAHHLVANKRNGELAALSRGGASNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDD 116
            |..|.::.|..|  :.........|....|.|.|||..|:|.||.|.|....:.:||.||.: .:
 Worm    26 AQRHSMLNNFNN--IVPQQLNEVENTAQKFCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVK-TE 87

  Fly   117 HGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPIKHVGPSDLFQNG 181
            ||...|.|.|::.|||:.|...|.:.::::|.:.|..|...|...:  |.:||            
 Worm    88 HGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTTV--RALPI------------ 138

  Fly   182 NGHKEAGPAAS 192
              |..||.|.:
 Worm   139 --HTSAGHAVT 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 28/78 (36%)
IbpA <79..170 CDD:223149 31/90 (34%)
sip-1NP_499316.1 IbpA <45..129 CDD:223149 29/84 (35%)
metazoan_ACD 45..126 CDD:107247 28/81 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.