DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Hspb1

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_038588.2 Gene:Hspb1 / 15507 MGIID:96240 Length:209 Species:Mus musculus


Alignment Length:129 Identity:46/129 - (35%)
Similarity:65/129 - (50%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LSRGGASNKQ--GNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLP 131
            ||.|.:..:|  ..:.|.|||..|.|.|||||.....:.:.||||||:|:||::||.|.|:|.||
Mouse    85 LSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLP 149

  Fly   132 KEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPIKHVGPSDLFQNGNGHKEAGPAASASE 195
            ...|...:.|:||.:|.|.:..|...:..:..|..||:.....:.:         .||.|..||
Mouse   150 PGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQI---------GGPEAGKSE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 34/80 (43%)
IbpA <79..170 CDD:223149 37/90 (41%)
Hspb1NP_038588.2 Interaction with TGFB1I1. /evidence=ECO:0000250 74..209 46/129 (36%)
ACD_HspB1_like 88..173 CDD:107230 35/84 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.