DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Cryab

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001276711.1 Gene:Cryab / 12955 MGIID:88516 Length:175 Species:Mus musculus


Alignment Length:120 Identity:47/120 - (39%)
Similarity:68/120 - (56%) Gaps:20/120 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVS 141
            ::..|.|:|||..|.|.||.||::.:.|.|.||||||:|:||.:||.|.|:|.:|.:.|...|.|
Mouse    71 EKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITS 135

  Fly   142 TLSEDGVLNITVPPLVSKEELK--ERIIPIKHVGPSDLFQNGNGHKEAGPAASAS 194
            :||.||||.:..|    ::::.  ||.|||.              :|..||.:|:
Mouse   136 SLSSDGVLTVNGP----RKQVSGPERTIPIT--------------REEKPAVAAA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 37/76 (49%)
IbpA <79..170 CDD:223149 42/92 (46%)
CryabNP_001276711.1 Crystallin 1..52 CDD:395419
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 38/82 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..175 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838980
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.