DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Cryaa

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001265498.1 Gene:Cryaa / 12954 MGIID:88515 Length:202 Species:Mus musculus


Alignment Length:195 Identity:60/195 - (30%)
Similarity:91/195 - (46%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IPFVLNLDSPDSMYYGHDMFPNRMYRRLHSRQHHDLDLHTLGLIARMG--AHAHHLVANKRNGEL 66
            :||:.:..||   ||...:|     |.:       ||.....|:..|.  .|..| ..|.:|..:
Mouse    37 LPFLSSTISP---YYRQSLF-----RTV-------LDSGISELMTHMWFVMHQPH-AGNPKNNPV 85

  Fly    67 AALSRGGASNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLP 131
            .|.......:.:..|.:.|||..|.|.:||||::.:.:.:.|||.||:||||::||.|.|||.||
Mouse    86 KASYMAKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLP 150

  Fly   132 KEFDSDAIVSTLSEDGVLNITVPPLVSKEEL--KERIIPIKHVGPSDLFQNGNGHKEAGPAASAS 194
            ...|..|:..:||.||:|..:.|.:.|..:.  .||.||:.              :|..|:::.|
Mouse   151 SNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVS--------------REEKPSSAPS 201

  Fly   195  194
            Mouse   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 34/78 (44%)
IbpA <79..170 CDD:223149 40/92 (43%)
CryaaNP_001265498.1 Crystallin 1..50 CDD:278926 6/15 (40%)
alpha-crystallin-Hsps_p23-like 90..174 CDD:294116 34/83 (41%)
IbpA <93..174 CDD:223149 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838986
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.