DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Cryaa

DIOPT Version :10

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001265498.1 Gene:Cryaa / 12954 MGIID:88515 Length:202 Species:Mus musculus


Alignment Length:195 Identity:60/195 - (30%)
Similarity:91/195 - (46%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IPFVLNLDSPDSMYYGHDMFPNRMYRRLHSRQHHDLDLHTLGLIARMG--AHAHHLVANKRNGEL 66
            :||:.:..||   ||...:|     |.:       ||.....|:..|.  .|..| ..|.:|..:
Mouse    37 LPFLSSTISP---YYRQSLF-----RTV-------LDSGISELMTHMWFVMHQPH-AGNPKNNPV 85

  Fly    67 AALSRGGASNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLP 131
            .|.......:.:..|.:.|||..|.|.:||||::.:.:.:.|||.||:||||::||.|.|||.||
Mouse    86 KASYMAKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLP 150

  Fly   132 KEFDSDAIVSTLSEDGVLNITVPPLVSKEEL--KERIIPIKHVGPSDLFQNGNGHKEAGPAASAS 194
            ...|..|:..:||.||:|..:.|.:.|..:.  .||.||:.              :|..|:::.|
Mouse   151 SNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVS--------------REEKPSSAPS 201

  Fly   195  194
            Mouse   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 34/78 (44%)
CryaaNP_001265498.1 Crystallin 1..54 CDD:425732 7/24 (29%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 90..174 CDD:469641 34/83 (41%)

Return to query results.
Submit another query.