DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and HSPB6

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_653218.1 Gene:HSPB6 / 126393 HGNCID:26511 Length:160 Species:Homo sapiens


Alignment Length:77 Identity:39/77 - (50%)
Similarity:49/77 - (63%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTL 143
            |:|.|.|||..|.|.|:.||:|.|.:.|..:||||.|:||.|:|.|.|||.||...|..|:.|.|
Human    72 GHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSAL 136

  Fly   144 SEDGVLNITVPP 155
            |.:|||:|...|
Human   137 SPEGVLSIQAAP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 38/74 (51%)
IbpA <79..170 CDD:223149 39/77 (51%)
HSPB6NP_653218.1 Involved in stabilization of the HSPB1:HSBP6 heterodimer. /evidence=ECO:0000269|PubMed:27717639 1..72 39/77 (51%)
Crystallin 3..58 CDD:395419
ACD_HspB4-5-6 66..144 CDD:107233 37/71 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.