Sequence 1: | NP_523994.1 | Gene: | Hsp67Bc / 39071 | FlyBaseID: | FBgn0001229 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001300979.1 | Gene: | CRYAA2 / 102724652 | -ID: | - | Length: | 173 | Species: | Homo sapiens |
Alignment Length: | 91 | Identity: | 39/91 - (42%) |
---|---|---|---|
Similarity: | 56/91 - (61%) | Gaps: | 2/91 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 FEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSE 145
Fly 146 DGVLNITVPPLVSKEEL--KERIIPI 169 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hsp67Bc | NP_523994.1 | metazoan_ACD | 75..154 | CDD:107247 | 34/72 (47%) |
IbpA | <79..170 | CDD:223149 | 39/91 (43%) | ||
CRYAA2 | NP_001300979.1 | Crystallin | 1..51 | CDD:395419 | |
ACD_alphaA-crystallin_HspB4 | 60..145 | CDD:107245 | 34/73 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165148919 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1187096at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000383 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45640 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X393 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.850 |