DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and CRYAA2

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001300979.1 Gene:CRYAA2 / 102724652 -ID:- Length:173 Species:Homo sapiens


Alignment Length:91 Identity:39/91 - (42%)
Similarity:56/91 - (61%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 FEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSE 145
            |.:.|||..|.|.:||||:.::.:.:.|||.||:||||::||.|.|||.||...|..|:..:||.
Human    71 FVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSA 135

  Fly   146 DGVLNITVPPLVSKEEL--KERIIPI 169
            ||:|....|.:.:..:.  .||.||:
Human   136 DGMLTFCGPKIQTGLDATHAERAIPV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 34/72 (47%)
IbpA <79..170 CDD:223149 39/91 (43%)
CRYAA2NP_001300979.1 Crystallin 1..51 CDD:395419
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 34/73 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148919
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.