DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hspb2

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_002932983.1 Gene:hspb2 / 100497635 XenbaseID:XB-GENE-940436 Length:179 Species:Xenopus tropicalis


Alignment Length:99 Identity:37/99 - (37%)
Similarity:56/99 - (56%) Gaps:6/99 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAI 139
            :..:..|:|.|||..|.|.|::|..::..:.|..||.::.|.||.|||.|.|:|.||.:.|...:
 Frog    65 NRNEHKFQVFLDVCHFLPDEISVHTMDNLLEVSAKHPQKIDSHGFVSRSFNRKYILPLDVDPLLV 129

  Fly   140 VSTLSEDGVLNITVPPLVSKE-ELK--ERIIPIK 170
            .:.||.||:|:|..|   .|| :||  ..::.||
 Frog   130 KAKLSHDGILSIEAP---RKEVDLKGENNVVKIK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 30/78 (38%)
IbpA <79..170 CDD:223149 35/93 (38%)
hspb2XP_002932983.1 Crystallin <21..51 CDD:278926
IbpA <63..149 CDD:223149 33/86 (38%)
alpha-crystallin-Hsps_p23-like 69..145 CDD:294116 31/78 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.