DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hspb6

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 / 100494296 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis


Alignment Length:111 Identity:47/111 - (42%)
Similarity:62/111 - (55%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RNGELAALSRGGASN---KQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRH 123
            |:..:...|..|.|.   .:..|.|.|||..|.|.|||||:|.:.:.|..|||||.|:||.:||.
 Frog    54 RSPSIPQPSEAGLSEVKLDKDQFSVLLDVKHFSPEELTVKVVGDYVEVHAKHEERPDEHGFISRE 118

  Fly   124 FVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPI 169
            |.|||.:|......||.|.||.:|:|:|..|.....:: :||.|||
 Frog   119 FHRRYKIPPTVSPAAISSALSAEGLLSIQAPVTAGGKQ-EERSIPI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 38/81 (47%)
IbpA <79..170 CDD:223149 43/91 (47%)
hspb6XP_002940672.2 Crystallin 1..56 CDD:366148 1/1 (100%)
ACD_HspB4-5-6 68..149 CDD:107233 37/80 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.