DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and LOC100489058

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_017950961.1 Gene:LOC100489058 / 100489058 -ID:- Length:215 Species:Xenopus tropicalis


Alignment Length:175 Identity:48/175 - (27%)
Similarity:74/175 - (42%) Gaps:28/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NRMYRRLHSRQHHDLDLHTLGLIARMGAHAHHLVANKRNGELAALSRGGASNKQGNFEVHLDVGL 89
            |..||.|    ..|:|:..:...:|          ..|..|....|.....:.:.:||:.|||..
 Frog    54 NEAYRLL----SQDMDMRRITDQSR----------QPRATETEGTSPSSGKDGKDHFELTLDVRD 104

  Fly    90 FQPGELTVKLVNECIVVEGKHEEREDDHG----HVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLN 150
            |.|.|||||:....::|.||.|.:.|...    |..|.:.|...||:..:.:.:|.:.|:||.|:
 Frog   105 FSPHELTVKMQGRRVIVIGKQERKSDSENGSYVHEYREWKREAELPEGVNPEQVVCSFSKDGHLH 169

  Fly   151 ITVPPLVSKEELKERIIPI---------KHVGPSDLFQNGNGHKE 186
            |..|.| :.....||.|||         :.:.|.....|.:|.::
 Frog   170 IQAPRL-ALPPAPERPIPISMDPAPRDAQEIPPDAQNSNADGEQQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 28/82 (34%)
IbpA <79..170 CDD:223149 35/103 (34%)
LOC100489058XP_017950961.1 ACD_HspB9_like 88..174 CDD:107236 28/85 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5129
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.