DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and si:dkey-1k23.3

DIOPT Version :10

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 / 100331249 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio


Alignment Length:133 Identity:44/133 - (33%)
Similarity:74/133 - (55%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GLIARMGAHAHHLVANKRNGELAALSRGGASN---KQGNFEVHLDVGLFQPGELTVKLVNECIVV 106
            |.:|.:...:...|.:|.:.||:    ||.|.   :...:::.|||..|.|.|::||:.:..:.:
Zfish    64 GFLAPLLQASGPAVFSKPHRELS----GGVSEVAAETCRWKISLDVNHFAPAEISVKIQHGFLEI 124

  Fly   107 EGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITVP----PLVSKEELKERII 167
            .||||||:|.||.::|.|.|:|.||...:.:.:.::||.||:|.:..|    ||.:     :.||
Zfish   125 AGKHEERQDGHGFIARSFTRKYNLPGGIEVENLQTSLSADGILTVEAPFPSIPLPA-----DVII 184

  Fly   168 PIK 170
            ||:
Zfish   185 PIQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 29/81 (36%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 88..172 CDD:469641 30/83 (36%)

Return to query results.
Submit another query.