DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and si:dkey-1k23.3

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_002662020.3 Gene:si:dkey-1k23.3 / 100331249 ZFINID:ZDB-GENE-160113-121 Length:365 Species:Danio rerio


Alignment Length:133 Identity:44/133 - (33%)
Similarity:74/133 - (55%) Gaps:16/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GLIARMGAHAHHLVANKRNGELAALSRGGASN---KQGNFEVHLDVGLFQPGELTVKLVNECIVV 106
            |.:|.:...:...|.:|.:.||:    ||.|.   :...:::.|||..|.|.|::||:.:..:.:
Zfish    64 GFLAPLLQASGPAVFSKPHRELS----GGVSEVAAETCRWKISLDVNHFAPAEISVKIQHGFLEI 124

  Fly   107 EGKHEEREDDHGHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITVP----PLVSKEELKERII 167
            .||||||:|.||.::|.|.|:|.||...:.:.:.::||.||:|.:..|    ||.:     :.||
Zfish   125 AGKHEERQDGHGFIARSFTRKYNLPGGIEVENLQTSLSADGILTVEAPFPSIPLPA-----DVII 184

  Fly   168 PIK 170
            ||:
Zfish   185 PIQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 29/81 (36%)
IbpA <79..170 CDD:223149 34/94 (36%)
si:dkey-1k23.3XP_002662020.3 alpha-crystallin-Hsps_p23-like 88..172 CDD:320797 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.