DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hspb9

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001108177.1 Gene:hspb9 / 100137108 ZFINID:ZDB-GENE-080214-6 Length:204 Species:Danio rerio


Alignment Length:98 Identity:26/98 - (26%)
Similarity:48/98 - (48%) Gaps:4/98 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KQGNFEVHLDVGLFQPGELTVKLVNECI-VVEGKHEEREDDHGHV---SRHFVRRYPLPKEFDSD 137
            |:.:..:.||...|.|.:::|.:....: |:.||..|:.......   ::.||:...||...|..
Zfish    84 KKQDVSLTLDTRGFSPEDVSVTVSGRRLEVMAGKRAEKNASSSSAESQAQEFVQAVQLPDHLDPA 148

  Fly   138 AIVSTLSEDGVLNITVPPLVSKEELKERIIPIK 170
            ::..:|.|||:|:|..|.....|..:|.::||:
Zfish   149 SLTCSLGEDGLLHIETPEETKDESSEEHVVPIR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 21/80 (26%)
IbpA <79..170 CDD:223149 24/94 (26%)
hspb9NP_001108177.1 IbpA 38..180 CDD:223149 24/95 (25%)
ACD_HspB9_like 79..166 CDD:107236 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582858
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.