DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and ycbX

DIOPT Version :10

Sequence 1:NP_523993.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_415467.1 Gene:ycbX / 945563 ECOCYCID:G6487 Length:369 Species:Escherichia coli


Alignment Length:77 Identity:19/77 - (24%)
Similarity:33/77 - (42%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 STDEIVNITY-----VDKDGKRTKVQGKVGDNVLYLAHRHGIEMEGACEASLACTTCHVYVQHDY 111
            :.|:..|||.     ||.|.:....:|.....:|......||.:..:|.|.: |.:|.|.:....
E. coli   276 AADDTANITQQPDANVDIDWQGQAFRGNNQQVLLEQLENQGIRIPYSCRAGI-CGSCRVQLLEGE 339

  Fly   112 LQKLKEAEEQED 123
            :..||::...:|
E. coli   340 VTPLKKSAMGDD 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_523993.1 PLN02593 57..172 CDD:178203 18/72 (25%)
ycbXNP_415467.1 YcbX 1..265 CDD:442450
Fdx 289..367 CDD:440398 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.