powered by:
Protein Alignment Fdx1 and COX15
DIOPT Version :9
Sequence 1: | NP_001189075.1 |
Gene: | Fdx1 / 39070 |
FlyBaseID: | FBgn0011769 |
Length: | 172 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011068.1 |
Gene: | COX15 / 856884 |
SGDID: | S000000943 |
Length: | 486 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 31 |
Identity: | 9/31 - (29%) |
Similarity: | 18/31 - (58%) |
Gaps: | 4/31 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LRRSAVHNSCKLISKQ---IAKPAFYTPHNA 33
:|::.::|..|.:|.: ::.|.| .||.|
Yeast 41 IRKTQLYNFKKTVSIRPFSLSSPVF-KPHVA 70
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Fdx1 | NP_001189075.1 |
PLN02593 |
57..172 |
CDD:178203 |
|
COX15 | NP_011068.1 |
COX15-CtaA |
15..451 |
CDD:418569 |
9/31 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R421 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.