DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and YAH1

DIOPT Version :9

Sequence 1:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_015071.1 Gene:YAH1 / 855824 SGDID:S000006173 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:53/120 - (44%)
Similarity:76/120 - (63%) Gaps:3/120 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 HGEFEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGDNVLYLAHRHGIEMEGACEASLACTTCHVY 106
            ||..  :.||..:|: .||::.|||.:...:...|:.:|.:|..|.::|||||..|.||:||||.
Yeast    49 HGHL--KKPKPGEEL-KITFILKDGSQKTYEVCEGETILDIAQGHNLDMEGACGGSCACSTCHVI 110

  Fly   107 VQHDYLQKLKEAEEQEDDLLDMAPFLRENSRLGCQILLDKSMEGMELELPKATRN 161
            |..||...|.|.|:.|:|:||:|..|.|.|||||||.:.|.::|:.:.||:.|||
Yeast   111 VDPDYYDALPEPEDDENDMLDLAYGLTETSRLGCQIKMSKDIDGIRVALPQMTRN 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 48/105 (46%)
YAH1NP_015071.1 PLN02593 63..165 CDD:178203 46/101 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346235
Domainoid 1 1.000 82 1.000 Domainoid score I1961
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31955
Inparanoid 1 1.050 106 1.000 Inparanoid score I1413
Isobase 1 0.950 - 0 Normalized mean entropy S1416
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003912
OrthoInspector 1 1.000 - - oto99618
orthoMCL 1 0.900 - - OOG6_100695
Panther 1 1.100 - - LDO PTHR23426
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.