DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and FD1

DIOPT Version :10

Sequence 1:NP_523993.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_172565.1 Gene:FD1 / 837639 AraportID:AT1G10960 Length:148 Species:Arabidopsis thaliana


Alignment Length:45 Identity:10/45 - (22%)
Similarity:26/45 - (57%) Gaps:2/45 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ITYVDKDGKRTKVQGKVGDNVLYLAHRHGIEMEGACEASLACTTC 103
            :.::..:|:: :|:.:....||..|...|:::..:|.|. :|::|
plant    57 VKFITPEGEQ-EVECEEDVYVLDAAEEAGLDLPYSCRAG-SCSSC 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_523993.1 PLN02593 57..172 CDD:178203 10/45 (22%)
FD1NP_172565.1 PLN03136 1..148 CDD:178681 10/45 (22%)

Return to query results.
Submit another query.