DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and MFDX2

DIOPT Version :9

Sequence 1:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001031685.1 Gene:MFDX2 / 827856 AraportID:AT4G21090 Length:197 Species:Arabidopsis thaliana


Alignment Length:176 Identity:72/176 - (40%)
Similarity:104/176 - (59%) Gaps:16/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLRRS--AVHNSCKLISKQIA--KPAFYTPHNALHT---TIPRRHGEFEWQDPKSTDEIVNITYV 62
            :|:||  ....|..::.:|..  |.|.::.::...|   |...:.||        ..|.:|:|:|
plant    30 ILQRSYGQYLQSSPMLQRQTRSFKEALFSNNHKFCTSFSTTSEKGGE--------KTEKINVTFV 86

  Fly    63 DKDGKRTKVQGKVGDNVLYLAHRHGIEMEGACEASLACTTCHVYVQH-DYLQKLKEAEEQEDDLL 126
            ||||:...::..||.|:|..||.:.||:|||||.||||:||||.|.. .|..||:|..::|:|:|
plant    87 DKDGEEIHIKVPVGMNILEAAHENDIELEGACEGSLACSTCHVIVMDTKYYNKLEEPTDEENDML 151

  Fly   127 DMAPFLRENSRLGCQILLDKSMEGMELELPKATRNFYVDGHKPKPH 172
            |:|..|...||||||::....::|:.|.:|.|||||.|||..||||
plant   152 DLAFGLTATSRLGCQVIAKPELDGVRLAIPSATRNFAVDGFVPKPH 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 58/115 (50%)
MFDX2NP_001031685.1 PLN02593 81..197 CDD:178203 58/115 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2693
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31955
Inparanoid 1 1.050 129 1.000 Inparanoid score I1892
OMA 1 1.010 - - QHG53940
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 1 1.000 - - FOG0003912
OrthoInspector 1 1.000 - - otm2594
orthoMCL 1 0.900 - - OOG6_100695
Panther 1 1.100 - - O PTHR23426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3215
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.