DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and MFDX1

DIOPT Version :9

Sequence 1:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001329852.1 Gene:MFDX1 / 825895 AraportID:AT4G05450 Length:197 Species:Arabidopsis thaliana


Alignment Length:185 Identity:71/185 - (38%)
Similarity:103/185 - (55%) Gaps:30/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ISKQIAKPAFYTPHNA--LHTT----------IPR--RHGEFEW---------------QDPKST 53
            |.||:|:..:...:..  ||.:          :||  |..:..|               ::....
plant    13 IVKQLAREGYLATYGTKNLHRSYGHYLQSLPVVPRQARTSQEAWFLKSHKFCTSSTTSSENGDEE 77

  Fly    54 DEIVNITYVDKDGKRTKVQGKVGDNVLYLAHRHGIEMEGACEASLACTTCHVYVQH-DYLQKLKE 117
            .|.:.|.:|||||:...|:..:|.:||..||.:.|::||||||||||:||||.|.. :|..||:|
plant    78 TEKITIIFVDKDGEEIPVKVPIGMSVLEAAHENDIDLEGACEASLACSTCHVIVMDTEYYNKLEE 142

  Fly   118 AEEQEDDLLDMAPFLRENSRLGCQILLDKSMEGMELELPKATRNFYVDGHKPKPH 172
            ..::|:|:||:|..|.|.||||||::....::|:.|.:|.|||||.|||..||||
plant   143 PTDEENDMLDLAFGLTETSRLGCQVIARPELDGVRLAIPSATRNFAVDGFVPKPH 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 58/115 (50%)
MFDX1NP_001329852.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 89 1.000 Domainoid score I2693
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31955
Inparanoid 1 1.050 129 1.000 Inparanoid score I1892
OMA 1 1.010 - - QHG53940
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 1 1.000 - - FOG0003912
OrthoInspector 1 1.000 - - otm2594
orthoMCL 1 0.900 - - OOG6_100695
Panther 1 1.100 - - O PTHR23426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3215
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.