DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and fdx2

DIOPT Version :9

Sequence 1:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001070132.1 Gene:fdx2 / 767726 ZFINID:ZDB-GENE-060929-1046 Length:195 Species:Danio rerio


Alignment Length:177 Identity:96/177 - (54%)
Similarity:120/177 - (67%) Gaps:15/177 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CLLLRRSAVHNSCKLISKQIAKPAFYTPHNALHTTIPRRHGEFEWQDPKSTDE-------IVNIT 60
            |.|||.    |.|...:.:.|...|..|...|.|:|    |..:.:|..:.:|       |||:.
Zfish    27 CPLLRL----NRCTGAAVRRAVDGFSAPSRRLRTSI----GVCQSEDSSAPEEDAHAQEHIVNVV 83

  Fly    61 YVDKDGKRTKVQGKVGDNVLYLAHRHGIEMEGACEASLACTTCHVYVQHDYLQKLKEAEEQEDDL 125
            |:|:.|:|..||.:||||||||||:|||::||||||||||:||||||...:..:|.|.||:|||:
Zfish    84 YIDRSGRRIPVQARVGDNVLYLAHKHGIDLEGACEASLACSTCHVYVSSGHYDRLPEPEEREDDM 148

  Fly   126 LDMAPFLRENSRLGCQILLDKSMEGMELELPKATRNFYVDGHKPKPH 172
            |||||.|:|||||||||:|...::||||.|||.|||||||||.||||
Zfish   149 LDMAPLLQENSRLGCQIILTPELDGMELTLPKVTRNFYVDGHVPKPH 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 78/114 (68%)
fdx2NP_001070132.1 PLN02593 80..195 CDD:178203 78/114 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595162
Domainoid 1 1.000 124 1.000 Domainoid score I5470
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31955
Inparanoid 1 1.050 190 1.000 Inparanoid score I3871
OMA 1 1.010 - - QHG53940
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 1 1.000 - - FOG0003912
OrthoInspector 1 1.000 - - oto40669
orthoMCL 1 0.900 - - OOG6_100695
Panther 1 1.100 - - LDO PTHR23426
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 1 1.000 - - X3215
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.