DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and fdx1b

DIOPT Version :9

Sequence 1:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001094419.1 Gene:fdx1b / 562135 ZFINID:ZDB-GENE-060526-382 Length:168 Species:Danio rerio


Alignment Length:156 Identity:44/156 - (28%)
Similarity:85/156 - (54%) Gaps:13/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLLRRSAVHNSCKLISKQIAKPAFYTPHNALHTTIPRRHGEFEWQDPKSTDEIVNITYVDKDGKR 68
            :|||.|:: .:|        .|.....|...|.|:|....:.:.....|:..:|:  :|::.|.:
Zfish     9 VLLRSSSL-LAC--------HPGSVRSHAEFHHTVPSLCSQSQLNGSSSSKVLVH--FVNQSGVK 62

  Fly    69 TKVQGKVGDNVLYLAHRHGIEME--GACEASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPF 131
            :.|....|:.:|.:..:..::..  ||||.:|||:|||:..:.:...||:...::|.|:||:|..
Zfish    63 SSVFVTEGETLLDVVIKKNLDFSGFGACEGTLACSTCHLIFEENVFDKLEPMVDEEIDMLDLAYG 127

  Fly   132 LRENSRLGCQILLDKSMEGMELELPK 157
            :.:.||||||:.:::.|:||.:.:|:
Zfish   128 ITKTSRLGCQVTVERWMDGMTVRVPQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 33/103 (32%)
fdx1bNP_001094419.1 fer2 51..157 CDD:294106 33/105 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.