powered by:
Protein Alignment Fdx1 and CG3803
DIOPT Version :9
Sequence 1: | NP_001189075.1 |
Gene: | Fdx1 / 39070 |
FlyBaseID: | FBgn0011769 |
Length: | 172 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611855.1 |
Gene: | CG3803 / 37809 |
FlyBaseID: | FBgn0034938 |
Length: | 393 |
Species: | Drosophila melanogaster |
Alignment Length: | 38 |
Identity: | 12/38 - (31%) |
Similarity: | 15/38 - (39%) |
Gaps: | 13/38 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MFCLLLRRSAVHNSCKLISKQIAKPAFYTPHNALHTTI 38
|..||.:|: |..||: .|...||.||
Fly 1 MLRLLQKRT---NLIKLV----------VPGPRLHQTI 25
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Fdx1 | NP_001189075.1 |
PLN02593 |
57..172 |
CDD:178203 |
|
CG3803 | NP_611855.1 |
COX15-CtaA |
49..379 |
CDD:280746 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R421 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.