DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and Y73F8A.27

DIOPT Version :9

Sequence 1:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_502861.1 Gene:Y73F8A.27 / 178434 WormBaseID:WBGene00013532 Length:169 Species:Caenorhabditis elegans


Alignment Length:147 Identity:91/147 - (61%)
Similarity:115/147 - (78%) Gaps:0/147 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AFYTPHNALHTTIPRRHGEFEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGDNVLYLAHRHGIEM 90
            ||...:....|:..|:.|:||::||||.||:||||||.:||...|::|||||||::||||:.|||
 Worm    23 AFPVKNRHFMTSSVRKTGDFEYEDPKSEDEVVNITYVLRDGTERKIRGKVGDNVMFLAHRYDIEM 87

  Fly    91 EGACEASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLRENSRLGCQILLDKSMEGMELEL 155
            ||||||||||:||||||...:..||.|..|:|||:|||||.|::||||||||:|.|.::|:.:.|
 Worm    88 EGACEASLACSTCHVYVDPAFQNKLPEPLEEEDDMLDMAPALKDNSRLGCQIVLTKELDGITVTL 152

  Fly   156 PKATRNFYVDGHKPKPH 172
            |..|||||||||.||||
 Worm   153 PTMTRNFYVDGHVPKPH 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 76/114 (67%)
Y73F8A.27NP_502861.1 PLN02593 54..169 CDD:178203 76/114 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166693
Domainoid 1 1.000 119 1.000 Domainoid score I3620
eggNOG 1 0.900 - - E1_COG0633
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31955
Inparanoid 1 1.050 196 1.000 Inparanoid score I2520
Isobase 1 0.950 - 0 Normalized mean entropy S1416
OMA 1 1.010 - - QHG53940
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 1 1.000 - - FOG0003912
OrthoInspector 1 1.000 - - oto17983
orthoMCL 1 0.900 - - OOG6_100695
Panther 1 1.100 - - LDO PTHR23426
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 1 1.000 - - X3215
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1716.790

Return to query results.
Submit another query.