DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and fdx1

DIOPT Version :9

Sequence 1:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:XP_002938002.1 Gene:fdx1 / 100379765 XenbaseID:XB-GENE-990886 Length:167 Species:Xenopus tropicalis


Alignment Length:148 Identity:53/148 - (35%)
Similarity:86/148 - (58%) Gaps:11/148 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CKLISKQIAKPAFYTPHNALHTTIPR--RHGEFEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGD 77
            |.|.|.::..||..|      ...||  |.|....:...|.|: |.:.::::||:....|||||:
 Frog    13 CLLGSSRLGVPAVRT------VMCPRSSRLGPGHIRAFSSEDK-VTVKFINRDGETLVAQGKVGE 70

  Fly    78 NVLYLAHRHGIEME--GACEASLACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLRENSRLGC 140
            ::|.:.....::::  ||||.:|||:|||:..:....|:|....::|.|:||:|..|.:.|||||
 Frog    71 SLLDVVVEKNLDIDGFGACEGTLACSTCHLIFEDHIFQQLDPITDEEMDMLDLAYGLTDTSRLGC 135

  Fly   141 QILLDKSMEGMELELPKA 158
            ||.|.|||.||.:::|::
 Frog   136 QICLKKSMNGMTVKVPES 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 41/104 (39%)
fdx1XP_002938002.1 fer2 50..162 CDD:381830 41/104 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R421
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.