DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fdx1 and fdx2

DIOPT Version :9

Sequence 1:NP_001189075.1 Gene:Fdx1 / 39070 FlyBaseID:FBgn0011769 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001120210.1 Gene:fdx2 / 100145258 XenbaseID:XB-GENE-5933678 Length:193 Species:Xenopus tropicalis


Alignment Length:139 Identity:78/139 - (56%)
Similarity:105/139 - (75%) Gaps:3/139 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TIPRRHG---EFEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGDNVLYLAHRHGIEMEGACEASL 98
            ::|...|   :.|.|..:.::|.|::.:||:.|:|..|:||||::||.||||..|::|||||:||
 Frog    55 SVPTPAGTESDAENQRSELSEETVDVVFVDRSGQRVPVKGKVGESVLCLAHRCNIDLEGACESSL 119

  Fly    99 ACTTCHVYVQHDYLQKLKEAEEQEDDLLDMAPFLRENSRLGCQILLDKSMEGMELELPKATRNFY 163
            ||:||||||..::..||.|.:|:|||:|||||.|:|||||||||:|.:.:.|.|..|||.|||||
 Frog   120 ACSTCHVYVNTEFFDKLPEPDEREDDMLDMAPLLQENSRLGCQIILTEELNGAEFTLPKITRNFY 184

  Fly   164 VDGHKPKPH 172
            ||||.||||
 Frog   185 VDGHVPKPH 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fdx1NP_001189075.1 PLN02593 57..172 CDD:178203 71/114 (62%)
fdx2NP_001120210.1 PLN02593 78..193 CDD:178203 71/114 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 113 1.000 Domainoid score I6110
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31955
Inparanoid 1 1.050 167 1.000 Inparanoid score I4045
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1380051at2759
OrthoFinder 1 1.000 - - FOG0003912
OrthoInspector 1 1.000 - - oto103788
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3215
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.