DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp67A and KIF22

DIOPT Version :9

Sequence 1:NP_001286999.1 Gene:Klp67A / 39068 FlyBaseID:FBgn0004379 Length:814 Species:Drosophila melanogaster
Sequence 2:XP_024306038.1 Gene:KIF22 / 3835 HGNCID:6391 Length:723 Species:Homo sapiens


Alignment Length:718 Identity:189/718 - (26%)
Similarity:291/718 - (40%) Gaps:192/718 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKVAVRVRPYNVRELEQKQRSIIKVMDRSALLFDPDEEDDEFFFQGAKQPYRDITKRMNKKLTM- 72
            ::||||:||:               :|.:|...||.      ..:|......:|....|.:.|: 
Human    44 VRVAVRLRPF---------------VDGTAGASDPP------CVRGMDSCSLEIANWRNHQETLK 87

  Fly    73 -EFDRVFDIDNSNQDLFEECTAPLVDAVLNGYNCSVFVYGATGAGKTFTMLGSEAHPGLTYLTMQ 136
             :||..:...::.||::.....|::..:|.|.|.||..||.||||||.|||||...||:....:.
Human    88 YQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNASVLAYGPTGAGKTHTMLGSPEQPGVIPRALM 152

  Fly   137 DLFDKIQ---AQSDVRKFDVGVSYLEVYNEHVMNLL-TKSGPLKLREDNNG-VVVSGLCLTPIYS 196
            ||....:   |:.......|.:||||:|.|.|::|| ..||.|.:|||..| :::.||...||.|
Human   153 DLLQLTREEGAEGRPWALSVTMSYLEIYQEKVLDLLDPASGDLVIREDCRGNILIPGLSQKPISS 217

  Fly   197 AEELLRMLMLGNSHRTQHPTDANAESSRSHAIFQVHIRITERKTD-TKRTVKLSMIDLAGSERAA 260
            ..:..|..:..:.:||...|..|..||||||:..|.:...||... .:|..||.:|||||||...
Human   218 FADFERHFLPASRNRTVGATRLNQRSSRSHAVLLVKVDQRERLAPFRQREGKLYLIDLAGSEDNR 282

  Fly   261 STKGIGVRFKEGASINKSLLALGNCINKLADGLKHIPYRDSNLTRILKDSLGGNCRTLMVANVSM 325
            .|...|:|.||..:||.||..||..::.|..||..:|||||.|||:|:|||||:..::::||::.
Human   283 RTGNKGLRLKESGAINTSLFVLGKVVDALNQGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAP 347

  Fly   326 SSLTYEDTYNTLKYASRAKKIRTTLKQNVLKSKMPTEFYVKKIDEVVAENERLKERNKALEAKAT 390
            ....|.||.:.|.:|:|:|::......|  :|..|     ..:..|....:.|....:|..|:..
Human   348 ERRFYLDTVSALNFAARSKEVINRPFTN--ESLQP-----HALGPVKLSQKELLGPPEAKRARGP 405

  Fly   391 QLERAGNSGFDPLELKTWYSKIDAVYAAARQLQEHVLGMRSKIKNINYRQTLKKELEEFRKLMCV 455
            :.|..|:.  :|:          |..|:|.|                       :|...:||..:
Human   406 EEEEIGSP--EPM----------AAPASASQ-----------------------KLSPLQKLSSM 435

  Fly   456 DQRVCQEDFRRFANYMSTLTSQMEKYKEELPSWLSKMEIAYQDLESLKREVNKSKAYQILIVYVK 520
            |..:.:    |..:....|.||   ..:..|.           |.:.|||      ..:|:..|:
Human   436 DPAMLE----RLLSLDRLLASQ---GSQGAPL-----------LSTPKRE------RMVLMKTVE 476

  Fly   521 YKDLELQLTKQNIFNNHVNAINQELVENLDLMRKSFRTACEVLNQTYDRLEDGQKLTPEIEAVFE 585
            .||||:                                         :||:..||   |:||  :
Human   477 EKDLEI-----------------------------------------ERLKTKQK---ELEA--K 495

  Fly   586 RLLRKMRFADSEANTKMAEMNPLAVPVALRSSAQEEEEPTCSLTASAKKR--------QRQAAQS 642
            .|.:|   |:.:.|.....:.||:             ..|.:.....||.        |.|||..
Human   496 MLAQK---AEEKENHCPTMLRPLS-------------HRTVTGAKPLKKAVVMPLQLIQEQAASP 544

  Fly   643 DDDLHL--------SMEDFDSQDTESDSEELHRTFKRP-------------------RNLNETQV 680
            :.::|:        .:|..|:.:.|..:|:.......|                   |:|...|.
Human   545 NAEIHILKNKGRKRKLESLDALEPEEKAEDCWELQISPELLAHGRQKILDLLNEGSARDLRSLQR 609

  Fly   681 LGP 683
            :||
Human   610 IGP 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp67ANP_001286999.1 KISc 8..353 CDD:214526 125/351 (36%)
KISc_KIP3_like 8..346 CDD:276821 125/344 (36%)
KIF22XP_024306038.1 KISc_KID_like 43..366 CDD:276827 124/342 (36%)
ComEA <596..632 CDD:333350 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000448
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.