DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and MRRF

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001333268.1 Gene:MRRF / 92399 HGNCID:7234 Length:283 Species:Homo sapiens


Alignment Length:250 Identity:87/250 - (34%)
Similarity:141/250 - (56%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LHLAALGVRQTRVSSSSPKLPLILQNNLENTKYLQVARDYAKGKDKKKEKGGKGK-PGKVEINEQ 69
            :|....|.||....|:.|                  .|.:|..|.|.|   |||: ..:|.||..
Human    55 VHERQHGHRQYMAYSAVP------------------VRHFATKKAKAK---GKGQSQTRVNINAA 98

  Fly    70 QLREILNFDGLNSQMQKSVMQMKEDFVKHLSLRSTSGAIDTLRIKVDGQEHELQELAQISRKNPK 134
            .:.:|:|.:.:|.:|:..:..:|::|.|.|::|::.|::|.:.:.....:..|.:::|||.|:|:
Human    99 LVEDIINLEEVNEEMKSVIEALKDNFNKTLNIRTSPGSLDKIAVVTADGKLALNQISQISMKSPQ 163

  Fly   135 TIIVNMIGFPQTIPDVLKAIEKSGMNLNPQQDGTTLFIPIPKVTKEHRENLSKNAKALFVKYRDA 199
            .|:|||..||:.....:|||.:|||||||:.:||.:.:|||:||:||||.|.|.||....|.:|:
Human   164 LILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRVPIPQVTREHREMLVKLAKQNTNKAKDS 228

  Fly   200 IRGVQNEHIRKLKKQPELGKDDAF-AAQAQVTAIADRFISEADKLLASKQKELLG 253
            :|.|:...:.||||..:...:|.. ..:.|::.:||..::|.|:.||.|.|||||
Human   229 LRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQMADDTVAELDRHLAVKTKELLG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 66/176 (38%)
MRRFNP_001333268.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143206
Domainoid 1 1.000 125 1.000 Domainoid score I5510
eggNOG 1 0.900 - - E1_COG0233
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12203
Inparanoid 1 1.050 146 1.000 Inparanoid score I4427
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62479
OrthoDB 1 1.010 - - D1472838at2759
OrthoFinder 1 1.000 - - FOG0003951
OrthoInspector 1 1.000 - - oto89832
orthoMCL 1 0.900 - - OOG6_101101
Panther 1 1.100 - - LDO PTHR20982
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2772
SonicParanoid 1 1.000 - - X5763
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.