DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and RRF1

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_011903.1 Gene:RRF1 / 856433 SGDID:S000001080 Length:230 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:35/170 - (20%)
Similarity:79/170 - (46%) Gaps:21/170 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KVEINEQQLREILNFDGLNSQMQKS--VMQMKEDFVKHLSLRSTSGAIDTLRIKVDGQEHELQEL 125
            |||.:|..:.|:|.  ...:|.:|:  :.:.|.:.:|..:....  ..::|..|   ...:..::
Yeast    40 KVEEDEIDVNELLK--KAETQFKKTLEIQKQKMNEIKQGNFNPK--VFNSLVFK---NNRKFTDI 97

  Fly   126 AQISRKNPKTIIVNMIGFPQTIPDVLKAIEKSGMNLNPQQ---DGTTLFIPIPKVTKEHRENLSK 187
            |..|.|....:::.:.. |:.:..|:..:..:.:||.|::   :...|.:.:|..|.|.|..::|
Yeast    98 ATTSLKGKNALLITVFD-PKDVKTVISGVLAANLNLTPERVPNNDLQLKVSLPPPTTESRLKVAK 161

  Fly   188 NAKALFVKY-----RDAIRGVQNEHIRKLKKQPELGKDDA 222
            :.|.:|.:|     :|::..::...:::.|   ...||||
Yeast   162 DLKRVFEEYKQSSLKDSLGTIRGSILKEFK---SFKKDDA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 29/157 (18%)
RRF1NP_011903.1 Frr 45..230 CDD:223311 32/165 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342007
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101101
Panther 1 1.100 - - LDO PTHR20982
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.