DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRRF1 and RRF

DIOPT Version :9

Sequence 1:NP_648302.2 Gene:mRRF1 / 39067 FlyBaseID:FBgn0035980 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_567141.1 Gene:RRF / 825494 AraportID:AT3G63190 Length:275 Species:Arabidopsis thaliana


Alignment Length:180 Identity:42/180 - (23%)
Similarity:93/180 - (51%) Gaps:12/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LNSQMQKSVMQMKEDFVKHLSLRSTSGAIDTLRIKVDGQEHELQELAQISRKNPKTIIVNMIGFP 144
            :.|:|:|::..::..|....:.||.:..:|.:.::..|....|:.:||||..:..::::....  
plant    99 VKSKMEKTIETLRTSFNSIRTGRSNAAMLDKIEVEYYGSPVSLKSIAQISTPDGSSLLLQPYD-- 161

  Fly   145 QTIPDVLKAIEK----SGMNLNPQQDGTTLFIPIPKVTKEHRENLSKNAKALFVKYRDAIRGVQN 205
               ...||||||    |.:.:.|..||..:.:.:|.:|.:.|:.|||.......:.:.|:|.::.
plant   162 ---KSSLKAIEKAIVNSDLGVTPNNDGDVIRLSLPPLTSDRRKELSKVVAKQSEEGKVALRNIRR 223

  Fly   206 EHIR---KLKKQPELGKDDAFAAQAQVTAIADRFISEADKLLASKQKELL 252
            :.::   ||:|:.:|.:|:.....:.:..:.|.::.:.::|...|:|||:
plant   224 DALKSYDKLEKEKKLSEDNVKDLSSDLQKLIDVYMKKIEELYKQKEKELM 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRRF1NP_648302.2 RRF 76..252 CDD:238288 41/178 (23%)
RRFNP_567141.1 frr 95..275 CDD:178850 42/180 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3109
eggNOG 1 0.900 - - E1_COG0233
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I2305
OMA 1 1.010 - - QHG62479
OrthoDB 1 1.010 - - D1472838at2759
OrthoFinder 1 1.000 - - FOG0003951
OrthoInspector 1 1.000 - - otm2546
orthoMCL 1 0.900 - - OOG6_101101
Panther 1 1.100 - - LDO PTHR20982
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.